PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do014165.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family TALE
Protein Properties Length: 569aa    MW: 61553.1 Da    PI: 6.2564
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do014165.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.31.3e-083423791954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+ +e+  LA+++gL+  qV++WF N R +
  Do014165.1 342 FEHflHPYPKDSEKLMLARQTGLSRGQVSNWFINARVR 379
                 554459******************************88 PP

2BELL1101.4e-35204275172
        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 erq+lq+k + L+ ll++Vd++Y++y++q+q+v+ssF+avag g+a+pYt+lAl++iSrhFr+L+dai  q+
  Do014165.1 204 ERQDLQNKVSALMALLDQVDRKYRHYHHQMQIVMSSFDAVAGAGAARPYTALALQTISRHFRSLRDAIGAQV 275
                 799*****************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.5E-46135273IPR006563POX domain
PfamPF075262.5E-47141271IPR006563POX domain
PROSITE profilePS5007112.001320383IPR001356Homeobox domain
SMARTSM003891.7E-9323387IPR001356Homeobox domain
CDDcd000863.07E-12323384No hitNo description
SuperFamilySSF466894.28E-17324390IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-27326389IPR009057Homeodomain-like
PfamPF059204.4E-17340379IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 569 aa     Download sequence    Send to blast
MATFFSASTD QRDLVGGGDM SFHHYTTSNP YSDSPTGGLM PFPATIVSEG HVAHGGDGRD  60
EPASFVNARD GPTSGAEMGL QTQLLMANAS AAQHQGLSLS LGTQGVPVSL YQYRQAGMVG  120
ASLLSPNQTT TASRNAQSIY IQNSRYLKAA RELMDEVVNV RDAIKRKGDK NQSKESGEGK  180
DTEKSEEKAD EHEGNSSAEL TPSERQDLQN KVSALMALLD QVDRKYRHYH HQMQIVMSSF  240
DAVAGAGAAR PYTALALQTI SRHFRSLRDA IGAQVQSLRR SLGEKDTSAQ GGGLSRLRYI  300
DQQLRQQRAM QQFGMMQQPQ HAWRPQRGLP ESAVSVLRAW LFEHFLHPYP KDSEKLMLAR  360
QTGLSRGQVS NWFINARVRL WKPMIEEMYK EEFGAEMDSH SSSENLGNKG KDEAISSEDH  420
DEFQSPSSAA KHGAVGHLNA FKSEAIGGMD AGGVGLSDLD GAIGTYATSL NLGAVGNGNS  480
GSSLLQDALA HHHHGDARFV AYGDMAGLGG YDGGSVSLTL GLQHCNDAGT VPAEQQALLY  540
GNAGDFEFMN GSEDRQRFGS SQLLHDFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A2e-17329386158Homeobox protein Meis1
4xrs_B2e-17329386158Homeobox protein Meis1
5bng_A2e-17329387159Homeobox protein Meis2
5bng_B2e-17329387159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7284970.0KJ728497.1 Zea mays clone pUT6802 HB transcription factor (HB64) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985591.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_004985592.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_004985593.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_004985594.10.0PREDICTED: BEL1-like homeodomain protein 7
SwissprotQ9SIW11e-125BLH7_ARATH; BEL1-like homeodomain protein 7
TrEMBLK4A7V40.0K4A7V4_SETIT; Uncharacterized protein
STRINGSi034960m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90138131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.11e-114BEL1-like homeodomain 7